PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_57427.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 350aa    MW: 38967.5 Da    PI: 7.8064
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_57427.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.63e-50161431128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                   lppGfrFhPtd e++ +yL +kv +k ++  +v+ evd+ k+ePw+Lp++v+ +ek+ yfFs++d ky+tg r+nrat++gyWkatgkdk++l   +
  MLOC_57427.1  16 LPPGFRFHPTDMEIIIFYLVPKVLKKAFDK-TVVGEVDLKKYEPWNLPNEVNMGEKDRYFFSQKDLKYPTGIRTNRATNAGYWKATGKDKAILLPaT 111
                   79*************************999.89***************99999****************************************9867 PP

           NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                   ++l+g+kktLvfykgrap+gekt+W+mheyr+
  MLOC_57427.1 112 TTLIGMKKTLVFYKGRAPRGEKTNWIMHEYRI 143
                   788***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-5610179IPR003441NAC domain
PROSITE profilePS5100553.91316179IPR003441NAC domain
PfamPF023652.3E-2617143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MASHLQVQQQ KQQLNLPPGF RFHPTDMEII IFYLVPKVLK KAFDKTVVGE VDLKKYEPWN  60
LPNEVNMGEK DRYFFSQKDL KYPTGIRTNR ATNAGYWKAT GKDKAILLPA TTTLIGMKKT  120
LVFYKGRAPR GEKTNWIMHE YRIEIGKQPT PDLPADITEA ATINASSKEE YVVCKIFHKS  180
TGPKKVVMSS YALPIPISMG ADQHQGFPES TTLAPLMDYD VFSSLAPPPP LSAASVYQMH  240
AIEAGSSMMG SVVFPMMNND YFGNNHHQMM ATPPQSTMSF NNHNQHQQMM HMSANRGFMA  300
GVDPGSSSSC IASQEDVMTG LSNNNHGYVG ASMSDEISSV NMGMDGMWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-5021851171NO APICAL MERISTEM PROTEIN
1ut4_B6e-5021851171NO APICAL MERISTEM PROTEIN
1ut7_A6e-5021851171NO APICAL MERISTEM PROTEIN
1ut7_B6e-5021851171NO APICAL MERISTEM PROTEIN
4dul_A6e-5021851171NAC domain-containing protein 19
4dul_B6e-5021851171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197610.0FR819761.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC009 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FLJ24e-69NC100_ARATH; NAC domain-containing protein 100
TrEMBLF6IAY00.0F6IAY0_HORVD; NAC transcription factor
STRINGMLOC_57427.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.14e-68NAC domain containing protein 58